Top UBASH3A
Localization (UniProt annotation) Cytoplasm Nucleus Function (UniProt annotation) Interferes with CBL-mediated down-regulation anddegradation of receptor-type tyrosine kinases Promotesaccumulation of activated target receptors, such as T-cellreceptors, EGFR and PDGFRB, on the cell surface Exhibitsnegligigle protein tyrosine phosphatase activity at neutral pHMay act as a dominant-negative regulator of UBASH3B-dependentdephosphorylation May inhibit dynamin-dependent endocyticpathways by functionally sequestering dynamin via its SH3 domain Catalytic Activity (UniProt annotation) NA Protein Sequence MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPIPQEYALFLCP
TGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCEDQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFF
VSGSPADVIREFAMTFATEASLLAGTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKYCSVKPCTKQLHLTLAHK
FYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIG
ISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLNSRKDGEASSRCSGEFLPQTARSLSSLQALQATVARKSVLV
VRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFA
SPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQE
YMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPP
VKTLTHGANAAFNWRNWISGN
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AIFM1 Affinity Capture-Western physical 17709377 , (Europe PMC )NA BioGRID ALK Affinity Capture-MS physical 14968112 , (Europe PMC )NA BioGRID CBL Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15107835 , 15159412 , 16429130 , 17709377 , (Europe PMC )NA BioGRID CBS Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CRK Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct DAZAP2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.49, 0.67 BioGRID, IntAct, MINT DNM1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17382318 , (Europe PMC )0.40 BioGRID, IntAct, MINT EGFR Affinity Capture-Western physical 15107835 , 15159412 , (Europe PMC )NA BioGRID KCNE1 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct PRKN Reconstituted Complex physical 17599067 , (Europe PMC )NA BioGRID REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct RNF41 Affinity Capture-Western, Reconstituted Complex physical 26390156 , (Europe PMC )NA BioGRID SF3B4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SPRY2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT TP53BP2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TRIM37 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID UBASH3A Affinity Capture-Western physical 15159412 , (Europe PMC )NA BioGRID UBASH3B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID UBC Reconstituted Complex, pull down physical, physical association 15159412 , 16429130 , 17599067 , (Europe PMC )0.40 BioGRID, IntAct, MINT UBE2L3 FRET physical 17588522 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CRK Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct DAZAP2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.49, 0.67 BioGRID, IntAct, MINT DNM1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17382318 , (Europe PMC )0.40 BioGRID, IntAct, MINT EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct PRKN pull down physical association 17599067 , (Europe PMC )0.40 IntAct, MINT REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SF3B4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SPRY2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT TP53BP2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TRIM37 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.56 IntAct UBC Reconstituted Complex, pull down physical, physical association 15159412 , 16429130 , 17599067 , (Europe PMC )0.40 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source DNM1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17382318 , (Europe PMC )0.40 BioGRID, IntAct, MINT PRKN pull down physical association 17599067 , (Europe PMC )0.40 IntAct, MINT SPRY2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT UBC Reconstituted Complex, pull down physical, physical association 15159412 , 16429130 , 17599067 , (Europe PMC )0.40 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AIFM1 Affinity Capture-Western physical 17709377 , (Europe PMC )NA BioGRID ALK Affinity Capture-MS physical 14968112 , (Europe PMC )NA BioGRID CBL Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15107835 , 15159412 , 16429130 , 17709377 , (Europe PMC )NA BioGRID CBS Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CRK Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct DAZAP2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.49, 0.67 BioGRID, IntAct, MINT DNM1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 17382318 , (Europe PMC )0.40 BioGRID, IntAct, MINT EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct EGFR Affinity Capture-Western physical 15107835 , 15159412 , (Europe PMC )NA BioGRID KCNE1 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct PRKN Reconstituted Complex physical 17599067 , (Europe PMC )NA BioGRID PRKN pull down physical association 17599067 , (Europe PMC )0.40 IntAct, MINT REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct RNF41 Affinity Capture-Western, Reconstituted Complex physical 26390156 , (Europe PMC )NA BioGRID SF3B4 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SPRY2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.67 BioGRID, IntAct, MINT TP53BP2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TRIM37 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID TRIM37 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.56 IntAct UBASH3A Affinity Capture-Western physical 15159412 , (Europe PMC )NA BioGRID UBASH3B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID UBC Reconstituted Complex, pull down physical, physical association 15159412 , 16429130 , 17599067 , (Europe PMC )0.40 BioGRID, IntAct, MINT UBE2L3 FRET physical 17588522 , (Europe PMC )NA BioGRID
Statistics
