- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Deposit Data
- Acknowledgement
- Contact
- Licence
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- Catalytic Site Atlas
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetwoKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- NCI Nature PID
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- PTP-Central
- EKPD
- HuPHo
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last update: 11 Mar, 2019
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last update: 11 Mar, 2019
Top
DNM1L
Gene Name  | DNM1L (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 3W6O |
| Synonyms | DNM1L, DLP1, DRP1 | |
| Protein Name | DNM1L | |
| Alternative Name(s) | Dynamin-1-like protein;3.6.5.5;Dnm1p/Vps1p-like protein;DVLP;Dynamin family member proline-rich carboxyl-terminal domain less;Dymple;Dynamin-like protein;Dynamin-like protein 4;Dynamin-like protein IV;HdynIV;Dynamin-related protein 1; | |
| Protein Family | Belongs to the TRAFAC class dynamin-like GTPasesuperfamily Dynamin/Fzo/YdjA family | |
| EntrezGene ID | 10059 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | O00429 (protein sequence) | |
| Enzyme Class | 3.6.5.5 (BRENDA ) | |
| Molecular Weight | 81877 Dalton | |
| Protein Length | 736 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000087470 (Ensembl) | UCSC | 1000 Genomes | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0446 | eggNOG - COG0699 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytosol Golgi apparatusEndomembrane system; Peripheral membrane protein Mitochondrionouter membrane ;Peripheral membrane protein Peroxisome Membrane, clathrin-coatedpit Cytoplasmic vesicle, secretory vesicle,synaptic vesicle membrane Note=Mainly cytosolicTranslocated to the mitochondrial membrane through O-GlcNAcylationand interaction with FIS1 Recruited to the mitochondrial outermembrane by interaction with MIEF1 Colocalized with MARCH5 atmitochondrial membrane Localizes to mitochondria at sites ofdivision Localizes to mitochondria following necrosis inductionAssociated with peroxisomal membranes, partly recruited there byPEX11B May also be associated with endoplasmic reticulum tubulesand cytoplasmic vesicles and found to be perinuclear In some celltypes, localizes to the Golgi complex Binds to phospholipidmembranes | |||
| Function (UniProt annotation) | |||
| Functions in mitochondrial and peroxisomal divisionMediates membrane fission through oligomerization into membrane-associated tubular structures that wrap around the scission siteto constrict and sever the mitochondrial membrane through a GTPhydrolysis-dependent mechanism Through its function inmitochondrial division, ensures the survival of at least sometypes of postmitotic neurons, including Purkinje cells, bysuppressing oxidative damage Required for normal braindevelopment, including that of cerebellum Facilitatesdevelopmentally regulated apoptosis during neural tube formationRequired for a normal rate of cytochrome c release and caspaseactivation during apoptosis; this requirement may depend upon thecell type and the physiological apoptotic cues Plays an importantrole in mitochondrial fission during mitosis (PubMed:26992161,PubMed:27301544, PubMed:27328748) Required for formation ofendocytic vesicles Proposed to regulate synaptic vesicle membranedynamics through association with BCL2L1 isoform Bcl-X(L) whichstimulates its GTPase activity in synaptic vesicles; the functionmay require its recruitment by MFF to clathrin-containingvesicles Required for programmed necrosis execution Isoform 1: Inhibits peroxisomal division whenoverexpressed Isoform 4: Inhibits peroxisomal division whenoverexpressed | |||
| Catalytic Activity (UniProt annotation) | |||
| GTP + H(2)O = GDP + phosphate | |||
| Protein Sequence | |||
| MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTG EENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPK DIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLN SYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNAT GPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLI QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSARE QRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKAL QGASQIIAEIRETHLW | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000139 | C:Golgi membrane |
| GO:0000266 | P:mitochondrial fission |
| GO:0001836 | P:release of cytochrome c from mitochondria |
| GO:0003374 | P:dynamin family protein polymerization involved in mitochondrial fission |
| GO:0003924 | F:GTPase activity |
| GO:0005096 | F:GTPase activator activity |
| GO:0005525 | F:GTP binding |
| GO:0005737 | C:cytoplasm |
| GO:0005739 | C:mitochondrion |
| GO:0005741 | C:mitochondrial outer membrane |
| GO:0005777 | C:peroxisome |
| GO:0005783 | C:endoplasmic reticulum |
| GO:0005789 | C:endoplasmic reticulum membrane |
| GO:0005794 | C:Golgi apparatus |
| GO:0005829 | C:cytosol |
| GO:0005874 | C:microtubule |
| GO:0005905 | C:clathrin-coated pit |
| GO:0007005 | P:mitochondrion organization |
| GO:0008017 | F:microtubule binding |
| GO:0008289 | F:lipid binding |
| GO:0010637 | P:negative regulation of mitochondrial fusion |
| GO:0010821 | P:regulation of mitochondrion organization |
| GO:0016020 | C:membrane |
| GO:0016559 | P:peroxisome fission |
| GO:0017137 | F:Rab GTPase binding |
| GO:0030054 | C:cell junction |
| GO:0030276 | F:clathrin binding |
| GO:0030672 | C:synaptic vesicle membrane |
| GO:0030742 | F:GTP-dependent protein binding |
| GO:0031625 | F:ubiquitin protein ligase binding |
| GO:0032459 | P:regulation of protein oligomerization |
| GO:0032991 | C:protein-containing complex |
| GO:0036466 | P:synaptic vesicle recycling via endosome |
| GO:0042802 | F:identical protein binding |
| GO:0042803 | F:protein homodimerization activity |
| GO:0043065 | P:positive regulation of apoptotic process |
| GO:0043231 | C:intracellular membrane-bounded organelle |
| GO:0043653 | P:mitochondrial fragmentation involved in apoptotic process |
| GO:0044877 | F:protein-containing complex binding |
| GO:0048312 | P:intracellular distribution of mitochondria |
| GO:0048471 | C:perinuclear region of cytoplasm |
| GO:0048488 | P:synaptic vesicle endocytosis |
| GO:0050714 | P:positive regulation of protein secretion |
| GO:0051259 | P:protein complex oligomerization |
| GO:0051289 | P:protein homotetramerization |
| GO:0051433 | F:BH2 domain binding |
| GO:0061003 | P:positive regulation of dendritic spine morphogenesis |
| GO:0061025 | P:membrane fusion |
| GO:0070266 | P:necroptotic process |
| GO:0070584 | P:mitochondrion morphogenesis |
| GO:0090141 | P:positive regulation of mitochondrial fission |
| GO:0090149 | P:mitochondrial membrane fission |
| GO:0090200 | P:positive regulation of release of cytochrome c from mitochondria |
| GO:0090650 | P:cellular response to oxygen-glucose deprivation |
| GO:0097194 | P:execution phase of apoptosis |
| GO:0098794 | C:postsynapse |
| GO:0098835 | C:presynaptic endocytic zone membrane |
| GO:1900063 | P:regulation of peroxisome organization |
| GO:1900244 | P:positive regulation of synaptic vesicle endocytosis |
| GO:1903146 | P:regulation of autophagy of mitochondrion |
| GO:1904579 | P:cellular response to thapsigargin |
| GO:1905395 | P:response to flavonoid |
| GO:1990910 | P:response to hypobaric hypoxia |
| GO:2000302 | P:positive regulation of synaptic vesicle exocytosis |
| GO:2001244 | P:positive regulation of intrinsic apoptotic signaling pathway |
DNM1L is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in DNM1L (O00429) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP3CA | Q08209 | Ser-637 _VARKLsAREQR, | In vivo | 18838687, 17721437, | Europe PMC |  |
| PPP3CB | P16298 | Ser-637 _VARKLsAREQR, | In vivo | 18838687, 17721437, | Europe PMC | |
| PPP3CC | P48454 | Ser-637 _VARKLsAREQR, | In vivo | 18838687, 17721437, | Europe PMC | |
| PGAM5 | Q96HS1 | Ser-637_VARKLsAREQR, | In vitro | 22265414, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04217 | Necroptosis | Necroptosis is a programmed form of necrosis. It can be initiated by different stimuli, such as tumor necrosis factor (TNF), TNF-related apoptosis-inducing ligand (TRAIL), Fas ligand (FasL), interferon (IFN), LPS, viral DNA or RNA, DNA-damage agent and requires the kinase activity of receptor-interacting protein 1 (RIPK1) and RIPK3. Its execution involves ROS generation, calcium overload, the opening of the mitochondrial permeability transition pore, mitochondrial fission, inflammatory response and chromatinolysis. Necroptosis participates in many pathogenesis of diseases, including neurological diseases, retinal disorders, acute kidney injury, inflammatory diseases and microbial infections. |
| hsa04621 | NOD-like receptor signaling pathway | Specific families of pattern recognition receptors are responsible for detecting various pathogens and generating innate immune responses. The intracellular NOD-like receptor (NLR) family contains more than 20 members in mammals and plays a pivotal role in the recognition of intracellular ligands. NOD1 and NOD2, two prototypic NLRs, sense the cytosolic presence of the bacterial peptidoglycan fragments that escaped from endosomal compartments, driving the activation of NF-{kappa}B and MAPK, cytokine production and apoptosis. On the other hand, a different set of NLRs induces caspase-1 activation through the assembly of multiprotein complexes called inflammasomes. The activated of caspase-1 regulates maturation of the pro-inflammatory cytokines IL-1B, IL-18 and drives pyroptosis. |
| hsa04668 | TNF signaling pathway | Tumor necrosis factor (TNF), as a critical cytokine, can induce a wide range of intracellular signal pathways including apoptosis and cell survival as well as inflammation and immunity. Activated TNF is assembled to a homotrimer and binds to its receptors (TNFR1, TNFR2) resulting in the trimerization of TNFR1 or TNFR2. TNFR1 is expressed by nearly all cells and is the major receptor for TNF (also called TNF-alpha). In contrast, TNFR2 is expressed in limited cells such as CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells. It is the receptor for both TNF and LTA (also called TNF-beta). Upon binding of the ligand, TNFR mediates the association of some adaptor proteins such as TRADD or TRAF2, which in turn initiate recruitment of signal transducers. TNFR1 signaling induces activation of many genes, primarily controlled by two distinct pathways, NF-kappa B pathway and the MAPK cascade, or apoptosis and necroptosis. TNFR2 signaling activates NF-kappa B pathway including PI3K-dependent NF-kappa B pathway and JNK pathway leading to survival. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-75153 | Apoptotic execution phase. | In the execution phase of apoptosis, effector caspases cleave vital cellular proteins leading to the morphological changes that characterize apoptosis. These changes include destruction of the nucleus and other organelles, DNA fragmentation, chromatin condensation, cell shrinkage and cell detachment and membrane blebbing (reviewed in Fischer et al., 2003) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACIN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACLY | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTN4 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| ACTR1A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCY | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHSA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ALDOA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APEH | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ARF1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARFIP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ATIC | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATP6V1C1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ATXN3 | Affinity Capture-MS | physical | 29111377, (Europe PMC) | NA | BioGRID |
| BUB3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CA14 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CALM1 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| CALM2 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| CALM3 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| CAPRIN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CARS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CCT2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCT7 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCT8 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC37 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CKB | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| CKMT1A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CKMT1B | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| CPNE2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CYHR1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DARS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCTN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX21 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX39B | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DGUOK | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DNAAF2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DNAJA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Reconstituted Complex, anti tag coimmunoprecipitation, cosedimentation in solution, cross-linking study, molecular sieving, x-ray crystallography | direct interaction, physical, physical association | 20850011, 21701560, 23530241, 23584531, (Europe PMC) | 0.40, 0.54, 0.62 | BioGRID, IntAct, MINT |
| DUSP23 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DYNC1H1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1B2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1D | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1G | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EGFR | Affinity Capture-MS | physical | 24797263, (Europe PMC) | NA | BioGRID |
| EIF2S1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF3A | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF3B | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF3D | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF3F | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF4A3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF5A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ERH | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EZR | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM129B | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FASN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FGL1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| FIS1 | Affinity Capture-Western, Reconstituted Complex | physical | 12861026, (Europe PMC) | NA | BioGRID |
| FZR1 | Biochemical Activity, Reconstituted Complex | physical | 21325626, (Europe PMC) | NA | BioGRID |
| GABRR1 | Affinity Capture-MS | physical | 16999686, (Europe PMC) | NA | BioGRID |
| GANAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GFAP | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GSK3B | Reconstituted Complex, Two-hybrid | physical | 9731200, (Europe PMC) | NA | BioGRID |
| HAX1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HIST1H2AB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H2AE | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| HNRNPA1L2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPDL | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPH3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HPRT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSD17B10 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90B1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPA4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPH1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ILF2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IMPDH2 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JMJD6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| KCTD12 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KPNB1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LARS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LDHA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LDHB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LLGL2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, protein kinase assay | colocalization, phosphorylation reaction, physical, physical association | 22228096, 22639965, 23813973, 24282027, (Europe PMC) | 0.44, 0.82 | BioGRID, IntAct |
| MAGEA1 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGEA3 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MARCH5 | Affinity Capture-Western | physical | 16874301, 16936636, (Europe PMC) | NA | BioGRID |
| MAT2A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MDH2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MFF | Reconstituted Complex, cross-linking study | physical, physical association | 23530241, 26358295, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MIEF1 | Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy | association, colocalization, physical, physical association | 21701560, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| MIEF2 | Reconstituted Complex, cross-linking study, fluorescence microscopy, two hybrid | colocalization, physical, physical association | 21508961, 23530241, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| MTHFD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MUL1 | Biochemical Activity | physical | 19407830, (Europe PMC) | NA | BioGRID |
| MYH11 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYL12A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NACA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NAP1L1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NME1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUFIP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PABPC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PAICS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PARK7 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PCMT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDHB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDIA6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PEX11A | Phenotypic Enhancement | genetic | 20826455, (Europe PMC) | NA | BioGRID |
| PEX11B | Phenotypic Enhancement | genetic | 20826455, (Europe PMC) | NA | BioGRID |
| PEX11G | Phenotypic Enhancement | genetic | 20826455, (Europe PMC) | NA | BioGRID |
| PEX14 | Co-purification, pull down | association, physical | 21525035, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PFDN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PFN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PGAM1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PINK1 | FRET | physical | 25591737, (Europe PMC) | NA | BioGRID |
| PLS3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PNN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PPIA | Affinity Capture-MS, anti tag coimmunoprecipitation, cross-linking study | association, physical | 26496610, 29128334, (Europe PMC) | 0.53 | BioGRID, IntAct |
| PRDX2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDX6 | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| PRKN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 21292769, (Europe PMC) | NA | BioGRID |
| PRMT1 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PSMA4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC5 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMD2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMG3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PTBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RANBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RARS | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| RBBP4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBM8A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBMXL2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RCC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RNPS1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPA3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL12 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL27 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL28 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL30 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRM2 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RTRAF | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| RUVBL1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RUVBL2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAE1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAFB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAP18 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SCG3 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SEC24A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SERBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SF3B6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SH3GL1 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SKP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| SOD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SOX2 | Affinity Capture-MS | physical | 23667531, (Europe PMC) | NA | BioGRID |
| SSB | Affinity Capture-MS, Co-fractionation, cross-linking study | association, physical | 22863883, 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STIP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUB1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUMO2 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| TAGLN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBC1D15 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TES | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TIMM13 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TKT | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TLN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPI1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPM1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRIM28 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TXN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBE2L3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UNK | Affinity Capture-RNA | physical | 25737280, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VPS26A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| XRCC5 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| XRCC6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZBTB24 | Reconstituted Complex | physical | 19074440, (Europe PMC) | NA | BioGRID |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACIN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACLY | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTN4 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| ACTR1A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCY | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHSA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AIFM1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ALDOA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARF1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| BCL2L1 | anti tag coimmunoprecipitation, gtpase assay | gtpase reaction, physical association | 18250306, 23792689, (Europe PMC) | 0.40, 0.44 | IntAct |
| BUB3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CAPRIN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCT2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCT7 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCT8 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC37 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CKB | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| CKMT1A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COX14 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| DARS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCTN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX21 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX39B | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNAJA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Reconstituted Complex, anti tag coimmunoprecipitation, cosedimentation in solution, cross-linking study, molecular sieving, x-ray crystallography | direct interaction, physical, physical association | 20850011, 21701560, 23530241, 23584531, (Europe PMC) | 0.40, 0.54, 0.62 | BioGRID, IntAct, MINT |
| DYNC1H1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EBI-17349367 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EEF1B2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1D | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1G | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2S1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2S3L | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3A | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3B | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3D | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3F | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF4A3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF5A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ERH | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR1 | phage display, two hybrid | direct interaction, physical association | 21217774, (Europe PMC) | 0.53 | IntAct |
| EZR | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FASN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GANAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GARS | fluorescence microscopy | colocalization | 29128334, (Europe PMC) | 0.27 | IntAct |
| GFAP | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H2AB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPA1L2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPDL | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPH3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HPRT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSD17B10 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA4P | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| HSP90AA5P | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| HSP90AB3P | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| HSP90B1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPA4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPD1 | cosedimentation in solution | colocalization | 21274005, (Europe PMC) | 0.35 | IntAct, MINT |
| HSPH1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ILF2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IMPDH2 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| IQGAP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KCTD12 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KPNB1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LARS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LDHA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LDHB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LLGL2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, protein kinase assay | colocalization, phosphorylation reaction, physical, physical association | 22228096, 22639965, 23813973, 24282027, (Europe PMC) | 0.44, 0.82 | BioGRID, IntAct |
| MAGEA1 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGEA3 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAT2A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MDH2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MFF | Reconstituted Complex, cross-linking study | physical, physical association | 23530241, 26358295, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MGST3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MIEF1 | Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy | association, colocalization, physical, physical association | 21701560, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| MIEF2 | Reconstituted Complex, cross-linking study, fluorescence microscopy, two hybrid | colocalization, physical, physical association | 21508961, 23530241, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| MTHFD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYH11 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYL12A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NACA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NAP1L1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NME1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PABPC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PAICS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PARK7 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PCMT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDHB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDIA6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PEX14 | Co-purification, pull down | association, physical | 21525035, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PFDN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PFN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PGAM1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PGAM5 | anti tag coimmunoprecipitation | physical association | 22265414, (Europe PMC) | 0.40 | IntAct |
| PLGRKT | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PLS3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PNN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| POTEKP | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PPIA | Affinity Capture-MS, anti tag coimmunoprecipitation, cross-linking study | association, physical | 26496610, 29128334, (Europe PMC) | 0.53 | BioGRID, IntAct |
| PRDX2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDX6 | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| PRMT1 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PSMA4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC5 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMD2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PTBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RANBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RARS | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| RBBP4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBM8A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBMXL2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RCC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RNPS1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPA3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL12 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL27 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL28 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL30 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRM2 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RTRAF | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| RUVBL1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RUVBL2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAE1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAFB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAMM50 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | direct interaction, physical association | 27059175, (Europe PMC) | 0.60 | IntAct, MINT |
| SAP18 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SCG3 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SCRIB | phage display | physical association | 24550280, (Europe PMC) | 0.40 | IntAct, MINT |
| SERBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SF3B6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SFXN1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SH3GL1 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SIRT3 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| SKP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNRPGP15 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| SOD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SSB | Affinity Capture-MS, Co-fractionation, cross-linking study | association, physical | 22863883, 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STIP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUB1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUMO2 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| TAGLN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TIMM13 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TKT | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TLN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TOMM20 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TOMM22 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TPI1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPM1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPM3 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| TRIM28 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TXN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBE2H | two hybrid | physical association | 19549727, (Europe PMC) | 0.37 | IntAct |
| UBE2L3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VCP | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| XRCC5 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| XRCC6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| DNM1L | Reconstituted Complex, anti tag coimmunoprecipitation, cosedimentation in solution, cross-linking study, molecular sieving, x-ray crystallography | direct interaction, physical, physical association | 20850011, 21701560, 23530241, 23584531, (Europe PMC) | 0.40, 0.54, 0.62 | BioGRID, IntAct, MINT |
| HSPD1 | cosedimentation in solution | colocalization | 21274005, (Europe PMC) | 0.35 | IntAct, MINT |
| MFF | Reconstituted Complex, cross-linking study | physical, physical association | 23530241, 26358295, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MIEF1 | Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy | association, colocalization, physical, physical association | 21701560, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| MIEF2 | Reconstituted Complex, cross-linking study, fluorescence microscopy, two hybrid | colocalization, physical, physical association | 21508961, 23530241, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| SAMM50 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | direct interaction, physical association | 27059175, (Europe PMC) | 0.60 | IntAct, MINT |
| SCRIB | phage display | physical association | 24550280, (Europe PMC) | 0.40 | IntAct, MINT |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACIN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACLY | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ACTN4 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| ACTN4 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| ACTR1A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHCY | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AHSA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| AIFM1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| ALDOA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APEH | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ARF1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ARFIP1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ATIC | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| ATP6V1C1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| ATXN3 | Affinity Capture-MS | physical | 29111377, (Europe PMC) | NA | BioGRID |
| BCL2L1 | anti tag coimmunoprecipitation, gtpase assay | gtpase reaction, physical association | 18250306, 23792689, (Europe PMC) | 0.40, 0.44 | IntAct |
| BUB3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CA14 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CALM1 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| CALM2 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| CALM3 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| CAPRIN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CARS | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CCT2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCT7 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CCT8 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC37 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDC5L | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| CDCA5 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CDK1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CKB | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| CKMT1A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CKMT1B | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| COPS5 | Affinity Capture-MS | physical | 21145461, (Europe PMC) | NA | BioGRID |
| COX14 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| CPNE2 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| CYHR1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DARS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DBN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCTN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX21 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DDX39B | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DGUOK | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DNAAF2 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| DNAJA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Reconstituted Complex, anti tag coimmunoprecipitation, cosedimentation in solution, cross-linking study, molecular sieving, x-ray crystallography | direct interaction, physical, physical association | 20850011, 21701560, 23530241, 23584531, (Europe PMC) | 0.40, 0.54, 0.62 | BioGRID, IntAct, MINT |
| DUSP23 | Affinity Capture-MS | physical | 28514442, (Europe PMC) | NA | BioGRID |
| DYNC1H1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EBI-17349367 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EEF1B2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1D | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF1G | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EEF2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EGFR | Affinity Capture-MS | physical | 24797263, (Europe PMC) | NA | BioGRID |
| EIF2S1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF2S3L | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3A | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF3A | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3B | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF3B | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3D | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF3D | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF3F | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| EIF3F | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| EIF4A3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EIF5A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ERH | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR1 | phage display, two hybrid | direct interaction, physical association | 21217774, (Europe PMC) | 0.53 | IntAct |
| EZR | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAM129B | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| FASN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FGL1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| FIS1 | Affinity Capture-Western, Reconstituted Complex | physical | 12861026, (Europe PMC) | NA | BioGRID |
| FZR1 | Biochemical Activity, Reconstituted Complex | physical | 21325626, (Europe PMC) | NA | BioGRID |
| GABRR1 | Affinity Capture-MS | physical | 16999686, (Europe PMC) | NA | BioGRID |
| GANAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GARS | fluorescence microscopy | colocalization | 29128334, (Europe PMC) | 0.27 | IntAct |
| GFAP | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| GSK3B | Reconstituted Complex, Two-hybrid | physical | 9731200, (Europe PMC) | NA | BioGRID |
| HAX1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| HIST1H2AB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HIST1H2AE | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| HNRNPA1L2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPDL | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HNRNPH3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HPRT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSD17B10 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA4P | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| HSP90AA5P | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| HSP90AB3P | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| HSP90B1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPA4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSPD1 | cosedimentation in solution | colocalization | 21274005, (Europe PMC) | 0.35 | IntAct, MINT |
| HSPH1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ILF2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| IMPDH2 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| IMPDH2 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| IQGAP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JMJD6 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| KCTD12 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| KPNB1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LARS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LDHA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LDHB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LLGL2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| LRRK2 | Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, protein kinase assay | colocalization, phosphorylation reaction, physical, physical association | 22228096, 22639965, 23813973, 24282027, (Europe PMC) | 0.44, 0.82 | BioGRID, IntAct |
| MAGEA1 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGEA3 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MARCH5 | Affinity Capture-Western | physical | 16874301, 16936636, (Europe PMC) | NA | BioGRID |
| MAT2A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MDH2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MFF | Reconstituted Complex, cross-linking study | physical, physical association | 23530241, 26358295, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MGST3 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| MIEF1 | Affinity Capture-Western, anti tag coimmunoprecipitation, fluorescence microscopy | association, colocalization, physical, physical association | 21701560, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| MIEF2 | Reconstituted Complex, cross-linking study, fluorescence microscopy, two hybrid | colocalization, physical, physical association | 21508961, 23530241, (Europe PMC) | 0.54 | BioGRID, IntAct, MINT |
| MTHFD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MUL1 | Biochemical Activity | physical | 19407830, (Europe PMC) | NA | BioGRID |
| MYH11 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYL12A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NACA | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NAP1L1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NME1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUFIP1 | Affinity Capture-MS | physical | 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PABPC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PAICS | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PARK7 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PARK7 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PCMT1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDHB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PDIA6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PEX11A | Phenotypic Enhancement | genetic | 20826455, (Europe PMC) | NA | BioGRID |
| PEX11B | Phenotypic Enhancement | genetic | 20826455, (Europe PMC) | NA | BioGRID |
| PEX11G | Phenotypic Enhancement | genetic | 20826455, (Europe PMC) | NA | BioGRID |
| PEX14 | Co-purification, pull down | association, physical | 21525035, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PFDN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PFN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PGAM1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PGAM5 | anti tag coimmunoprecipitation | physical association | 22265414, (Europe PMC) | 0.40 | IntAct |
| PINK1 | FRET | physical | 25591737, (Europe PMC) | NA | BioGRID |
| PLGRKT | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| PLS3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PNN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| POTEKP | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PPIA | Affinity Capture-MS, anti tag coimmunoprecipitation, cross-linking study | association, physical | 26496610, 29128334, (Europe PMC) | 0.53 | BioGRID, IntAct |
| PRDX2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PRDX6 | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| PRKN | Affinity Capture-Western, Biochemical Activity, Reconstituted Complex | physical | 21292769, (Europe PMC) | NA | BioGRID |
| PRMT1 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PRMT1 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PSMA4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC5 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMC6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMD2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSMG3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| PTBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RANBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RARS | Affinity Capture-MS, cross-linking study, fluorescence microscopy | association, colocalization, physical | 29128334, (Europe PMC) | 0.43 | BioGRID, IntAct |
| RBBP4 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBM8A | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RBMXL2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RCC1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RNPS1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPA3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL12 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL27 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL28 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RPL30 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RRM2 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| RTRAF | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| RTRAF | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| RUVBL1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| RUVBL2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAE1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAFB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SAMM50 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation | direct interaction, physical association | 27059175, (Europe PMC) | 0.60 | IntAct, MINT |
| SAP18 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SCG3 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SCRIB | phage display | physical association | 24550280, (Europe PMC) | 0.40 | IntAct, MINT |
| SEC24A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SERBP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SF3B6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SFXN1 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| SH3GL1 | Two-hybrid, two hybrid | physical, physical association | 18330356, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SIRT3 | two hybrid pooling approach | physical association | 16169070, (Europe PMC) | 0.37 | IntAct |
| SKP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SNRPGP15 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| SNW1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20467437, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| SOD1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SOX2 | Affinity Capture-MS | physical | 23667531, (Europe PMC) | NA | BioGRID |
| SSB | Affinity Capture-MS, Co-fractionation, cross-linking study | association, physical | 22863883, 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| STIP1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUB1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| SUMO2 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| SUMO2 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| TAGLN2 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TBC1D15 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| TES | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TIMM13 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TKT | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TLN1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TOMM20 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TOMM22 | proximity-dependent biotin identification | association | 29568061, (Europe PMC) | 0.35 | IntAct |
| TPI1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPM1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TPM3 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| TRIM28 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TXN | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBA1 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UBE2H | two hybrid | physical association | 19549727, (Europe PMC) | 0.37 | IntAct |
| UBE2L3 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| UNK | Affinity Capture-RNA | physical | 25737280, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| VPS26A | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| XRCC5 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| XRCC6 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAB | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAE | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAQ | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| YWHAZ | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ZBTB24 | Reconstituted Complex | physical | 19074440, (Europe PMC) | NA | BioGRID |