Top HDAC7
Localization (UniProt annotation) Nucleus Cytoplasm Note=In the nucleus, itassociates with distinct subnuclear dot-like structures Shuttlesbetween the nucleus and the cytoplasm Treatment with EDN1 resultsin shuttling from the nucleus to the perinuclear region Theexport to cytoplasm depends on the interaction with the 14-3-3protein YWHAE and is due to its phosphorylation Function (UniProt annotation) Responsible for the deacetylation of lysine residues onthe N-terminal part of the core histones (H2A, H2B, H3 and H4)Histone deacetylation gives a tag for epigenetic repression andplays an important role in transcriptional regulation, cell cycleprogression and developmental events Histone deacetylases act viathe formation of large multiprotein complexes Involved in musclematuration by repressing transcription of myocyte enhancer factorssuch as MEF2A, MEF2B and MEF2C During muscle differentiation, itshuttles into the cytoplasm, allowing the expression of myocyteenhancer factors (By similarity) May be involved in Epstein-Barrvirus (EBV) latency, possibly by repressing the viral BZLF1 genePositively regulates the transcriptional repressor activity ofFOXP3 (PubMed:17360565) Catalytic Activity (UniProt annotation) Hydrolysis of an N(6)-acetyl-lysine residue ofa histone to yield a deacetylated histone Protein Sequence MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAV
ASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLK
LRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSV
APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAP
LLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRL
RQIPSAEDLETDGGGPGQVVDDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGL
RSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARW
AAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGF
DAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNA
IRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
HDAC7 is dephosphorylated by following phosphatases:
Phosphatase Gene Name Phosphatase UniProt_AC DephosphoSite and sequence (+/-5) in HDAC7 (Q8WUI4) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction PPP2CA P67775 Ser-155_LRKTVsEPNLK, , Ser-181_LLRKEsAPPSL, , Ser-321_LSRTRsEPLPP, , Ser-449 in isoform 3_LSRAQsSPAAP , In vitro and in vivo 18339811 , Europe PMC PPP2CB P62714 Ser-155_LRKTVsEPNLK, , Ser-181_LLRKEsAPPSL, , Ser-321_LSRTRsEPLPP, , Ser-449 in isoform 3_LSRAQsSPAAP , In vitro and in vivo 18339811 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa05034 Alcoholism Alcoholism, also called dependence on alcohol (ethanol), is a chronic relapsing disorder that is progressive and has serious detrimental health outcomes. As one of the primary mediators of the rewarding effects of alcohol, dopaminergic ventral tegmental area (VTA) projections to the nucleus accumbens (NAc) have been identified. Acute exposure to alcohol stimulates dopamine release into the NAc, which activates D1 receptors, stimulating PKA signaling and subsequent CREB-mediated gene expression, whereas chronic alcohol exposure leads to an adaptive downregulation of this pathway, in particular of CREB function. The decreased CREB function in the NAc may promote the intake of drugs of abuse to achieve an increase in reward and thus may be involved in the regulation of positive affective states of addiction. PKA signaling also affects NMDA receptor activity and may play an important role in neuroadaptation in response to chronic alcohol exposure. hsa05165 Human papillomavirus infection Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation. hsa05203 Viral carcinogenesis There is a strong association between viruses and the development of human malignancies. We now know that at least six human viruses, Epstein-Barr virus (EBV), hepatitis B virus (HBV), hepatitis C virus (HCV), human papilloma virus (HPV), human T-cell lymphotropic virus (HTLV-1) and Kaposi's associated sarcoma virus (KSHV) contribute to 10-15% of the cancers worldwide. Via expression of many potent oncoproteins, these tumor viruses promote an aberrant cell-proliferation via modulating cellular cell-signaling pathways and escape from cellular defense system such as blocking apoptosis. Human tumor virus oncoproteins can also disrupt pathways that are necessary for the maintenance of the integrity of host cellular genome. Viruses that encode such activities can contribute to initiation as well as progression of human cancers.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-2122947 NOTCH1 Intracellular Domain Regulates Transcription. NICD1 produced by activation of NOTCH1 in response to Delta and Jagged ligands (DLL/JAG) presented in trans, traffics to the nucleus where it acts as a transcription regulator. In the nucleus, NICD1 displaces the NCOR corepressor complex from RBPJ (CSL). When bound to the co-repressor complex that includes NCOR proteins (NCOR1 and NCOR2) and HDAC histone deacetylases, RBPJ (CSL) represses transcription of NOTCH target genes (Kao et al. 1998, Zhou et al. 2000, Perissi et al. 2004, Perissi et al. 2008). Once the co-repressor complex is displaced, NICD1 recruits MAML (mastermind-like) to RBPJ, while MAML recruits histone acetyltransferases EP300 (p300) and PCAF, resulting in formation of the NOTCH coactivator complex that activates transcription from NOTCH regulatory elements. The minimal functional NOTCH coactivator complex that activates transcription from NOTCH regulatory elements is a heterotrimer composed of NICD, MAML and RBPJ (Fryer et al. 2002, Wallberg et al. 2002, Nam et al. 2006). NOTCH1 coactivator complex is known to activate transcription of HES1 (Jarriault et al. 1995), HES5 (Arnett et al. 2010), HEY genes (Fischer et al. 2004, Leimeister et al. 2000, Maier et al. 2000, Arnett et al. 2010) and MYC (Palomero et al. 2006) and likely regulates transcription of many other genes (Wang et al. 2011). NOTCH1 coactivator complex on any specific regulatory element may involve additional transcriptional regulatory proteins. HES1 binds TLE proteins, forming an evolutionarily conserved transcriptional corepressor involved in regulation of neurogenesis, segmentation and sex determination (Grbavec et al. 1996, Fisher et al. 1996, Paroush et al. 1994). After NOTCH1 coactivator complex is assembled on a NOTCH-responsive promoter, MAML (mastermind-like) recruits CDK8 in complex with cyclin C, triggering phosphorylation of conserved serine residues in TAD and PEST domains of NICD1 by CDK8. Phosphorylated NICD1 is recognized by the E3 ubiquitin ligase FBXW7 which ubiquitinates NICD1, leading to degradation of NICD1 and downregulation of NOTCH1 signaling. FBXW7-mediated ubiquitination and degradation of NOTCH1 depend on C-terminally located PEST domain sequences in NOTCH1 (Fryer et al. 2004, Oberg et al. 2001, Wu et al. 2001). The PEST domain of NOTCH1 and the substrate binding WD40 domain of FBXW7 are frequent targets of mutations in T-cell acute lymphoblastic leukemia - T-ALL (Welcker and Clurman 2008). NICD1, which normally has a short half-life, can be stabilized by binding to the hypoxia-inducable factor 1-alpha (HIF1A) which accumulates in the nucleus when oxygen levels are low. This results in HIF1A-induced inhibition of cellular differentiation that is NOTCH-dependent (Gustafsson et al. 2005) R-HSA-2644606 Constitutive Signaling by NOTCH1 PEST Domain Mutants. As NOTCH1 PEST domain is intracellular, NOTCH1 PEST domain mutants are expected to behave as the wild-type NOTCH1 with respect to ligand binding and proteolytic cleavage mediated activation of signaling. However, once the NICD1 fragment of NOTCH1 is released, PEST domain mutations prolong its half-life and transcriptional activity through interference with FBXW7 (FBW7)-mediated ubiquitination and degradation of NICD1 (Weng et al. 2004, Thompson et al. 2007, O'Neil et al. 2007). All NOTCH1 PEST domain mutants annotated here (NOTCH1 Q2395*, NOTCH1 Q2440*, NOTCH1 P2474Afs*4 and NOTCH1 P2514Rfs*4) either have a truncated PEST domain or lack the PEST domain completely R-HSA-2894862 Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants. When found in cis, HD and PEST domain mutations act synergistically, increasing NOTCH1 transcriptional activity up to ~40-fold, compared with up to ~10-fold and up to ~2-fold increase with HD mutations alone and PEST domain mutations alone, respectively (Weng et al. 2004). HD domain mutations enable spontaneous, ligand-independent, proteolytic release of the NICD1 fragment, although mutants remain responsive to ligand binding (Malecki et al. 2006), while PEST domain mutations prolong NICD1 half-life and transcriptional activity through interference with FBXW7 (FBW7)-mediated ubiquitination and degradation (Thompson et al. 2007, O'Neil et al. 2007). NOTCH1 HD+PEST domain mutants annotated here are NOTCH1 L1600P;P2514Rfs*4, NOTCH1 L1600P;Q2440*, NOTCH1 L1600P;Q2395* and NOTCH1 L1574P;P2474Afs*4 R-HSA-3108214 SUMOylation of DNA damage response and repair proteins. Several factors that participate in DNA damage response and repair are SUMOylated (reviewed in Dou et al. 2011, Bekker-Jensen and Mailand 2011, Ulrich 2012, Psakhye and Jentsch 2012, Bologna and Ferrari 2013, Flotho and Melchior 2013, Jackson and Durocher 2013). SUMOylation can alter enzymatic activity and protein stability or it can serve to recruit additional factors. For example, SUMOylation of Thymine DNA glycosylase (TDG) causes TDG to lose affinity for its product, an abasic site opposite a G residue, and thus increases turnover of the enzyme. During repair of double-strand breaks SUMO1, SUMO2, SUMO3, and the SUMO E3 ligases PIAS1 and PIAS4 accumulate at double-strand breaks where BRCA1, HERC1, RNF168, MDC1, and TP53BP1 are SUMOylated. SUMOylation of BRCA1 may increase its ubiquitin ligase activity while SUMOylation of MDC1 and HERC2 appears to play a role in recruitment of proteins such as RNF4 and RNF8 to double strand breaks. Similarly SUMOylation of RPA1 (RPA70) recruits RAD51 in the homologous recombination pathway R-HSA-8943724 Regulation of PTEN gene transcription. Transcription of the PTEN gene is regulated at multiple levels. Epigenetic repression involves the recruitment of Mi-2/NuRD upon SALL4 binding to the PTEN promoter (Yang et al. 2008, Lu et al. 2009) or EVI1-mediated recruitment of the polycomb repressor complex (PRC) to the PTEN promoter (Song et al. 2009, Yoshimi et al. 2011). Transcriptional regulation is also elicited by negative regulators, including NR2E1:ATN1 (atrophin-1) complex, JUN (c-Jun), SNAIL and SLUG (Zhang et al. 2006, Vasudevan et al. 2007, Escriva et al. 2008, Uygur et al. 2015) and positive regulators such as TP53 (p53), MAF1, ATF2, EGR1 or PPARG (Stambolic et al. 2001, Virolle et al. 2001, Patel et al. 2001, Shen et al. 2006, Li et al. 2016)
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ADNP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AKAP12 Synthetic Rescue genetic 22584896 , (Europe PMC )NA BioGRID AR Affinity Capture-Western physical 16860317 , (Europe PMC )NA BioGRID BCL6 Affinity Capture-Western, Reconstituted Complex physical 11929873 , (Europe PMC )NA BioGRID BCORL1 Affinity Capture-Western physical 17379597 , (Europe PMC )NA BioGRID CALCOCO2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.37, 0.49, 0.56 BioGRID, IntAct, MINT CASP8 Biochemical Activity physical 18458084 , (Europe PMC )NA BioGRID CBWD6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CTNNB1 Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 20224040 , 21836063 , (Europe PMC )NA BioGRID DCAF10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID EDNRA Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11262386 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , (Europe PMC )0.51 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EP300 Affinity Capture-Western physical 15280364 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western physical 19917725 , (Europe PMC )NA BioGRID FLYWCH2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FOXA1 Affinity Capture-Western physical 19917725 , (Europe PMC )NA BioGRID FOXP3 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17360565 , (Europe PMC )0.40 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct GNMT Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT HDAC1 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC2 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC3 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 11466315 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct HDAC4 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC5 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC7 Affinity Capture-MS, Reconstituted Complex physical 11279209 , 23752268 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western, Two-hybrid physical 15280364 , 21148070 , (Europe PMC )NA BioGRID HINT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IKZF1 Affinity Capture-Western physical 12015313 , (Europe PMC )NA BioGRID IKZF3 Affinity Capture-Western physical 12015313 , (Europe PMC )NA BioGRID IKZF4 Affinity Capture-Western physical 12015313 , (Europe PMC )NA BioGRID INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KAT5 Affinity Capture-Western, Two-hybrid physical 12551922 , (Europe PMC )NA BioGRID KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KDM5B Affinity Capture-Western physical 17373667 , (Europe PMC )NA BioGRID KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KLF4 Affinity Capture-Western physical 17827213 , (Europe PMC )NA BioGRID KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MARK2 Affinity Capture-Western, Biochemical Activity physical 16980613 , (Europe PMC )NA BioGRID MARK3 Affinity Capture-Western, Biochemical Activity physical 16980613 , (Europe PMC )NA BioGRID MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MEF2A Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16956611 , 16980305 , 20590529 , 22308472 , (Europe PMC )NA BioGRID MEF2C Affinity Capture-Western, Reconstituted Complex physical 11279209 , 18463162 , (Europe PMC )NA BioGRID MOCOS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID NCOR1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 11466315 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct NCOR2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 11466315 , 16956611 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct NR2E1 Affinity Capture-Western physical 17873065 , (Europe PMC )NA BioGRID NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID PML Affinity Capture-Western physical 18463162 , 22155184 , (Europe PMC )NA BioGRID PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1CB Affinity Capture-MS, Affinity Capture-Western physical 17369396 , (Europe PMC )NA BioGRID PPP1R12A Affinity Capture-MS, Affinity Capture-Western physical 17369396 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-Western, Biochemical Activity physical 18339811 , (Europe PMC )NA BioGRID PRKD1 Affinity Capture-Western physical 19029091 , (Europe PMC )NA BioGRID PRKD2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 17962809 , (Europe PMC )0.64 BioGRID, IntAct, MINT RAP1GDS1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.49, 0.56 BioGRID, IntAct RHOA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RIPPLY1 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID RUNX2 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 17997710 , (Europe PMC )NA BioGRID SFN Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 15778465 , 18339811 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SHMT2 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TBL1X Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct TBL1XR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TTF2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID UBE2I Affinity Capture-Western, Reconstituted Complex physical 18625722 , (Europe PMC )NA BioGRID UGP2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WDR73 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17369396 , 23752268 , 24255178 , (Europe PMC )0.53 BioGRID, IntAct YWHAE Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17369396 , 17979178 , 20224040 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17979178 , 20224040 , 23752268 , 26496610 , (Europe PMC )0.35, 0.53 BioGRID, IntAct YWHAQ Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 15161933 , 16956611 , 16980613 , 17369396 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15161933 , 20224040 , 23752268 , (Europe PMC )0.67 BioGRID, IntAct, MINT ZBTB16 Reconstituted Complex physical 11929873 , (Europe PMC )NA BioGRID ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZFP36 Affinity Capture-Western physical 19738286 , (Europe PMC )NA BioGRID ZMYM6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZYG11B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EGFR Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , (Europe PMC )0.51 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct FOXP3 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17360565 , (Europe PMC )0.40 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct GNMT Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT HDAC3 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 11466315 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MEF2C anti tag coimmunoprecipitation association 23752268 , (Europe PMC )0.35 IntAct NCOR1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 11466315 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct NCOR2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 11466315 , 16956611 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PRKD2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 17962809 , (Europe PMC )0.64 BioGRID, IntAct, MINT REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.49, 0.56 BioGRID, IntAct RIPPLY1 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.49, 0.56 IntAct SDCBP phage display direct interaction 26787460 , (Europe PMC )0.44 IntAct, MINT SFN Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 15778465 , 18339811 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TBL1X Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct TBL1XR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct YWHAB Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17369396 , 23752268 , 24255178 , (Europe PMC )0.53 BioGRID, IntAct YWHAE Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17369396 , 17979178 , 20224040 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17979178 , 20224040 , 23752268 , 26496610 , (Europe PMC )0.35, 0.53 BioGRID, IntAct YWHAQ Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 15161933 , 16956611 , 16980613 , 17369396 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15161933 , 20224040 , 23752268 , (Europe PMC )0.67 BioGRID, IntAct, MINT ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source GNMT Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT PRKD2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 17962809 , (Europe PMC )0.64 BioGRID, IntAct, MINT SDCBP phage display direct interaction 26787460 , (Europe PMC )0.44 IntAct, MINT SFN Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 15778465 , 18339811 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15161933 , 20224040 , 23752268 , (Europe PMC )0.67 BioGRID, IntAct, MINT
Visualize Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ADNP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AKAP12 Synthetic Rescue genetic 22584896 , (Europe PMC )NA BioGRID AR Affinity Capture-Western physical 16860317 , (Europe PMC )NA BioGRID BCL6 Affinity Capture-Western, Reconstituted Complex physical 11929873 , (Europe PMC )NA BioGRID BCORL1 Affinity Capture-Western physical 17379597 , (Europe PMC )NA BioGRID CALCOCO2 Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 21516116 , 25416956 , (Europe PMC )0.37, 0.49, 0.56 BioGRID, IntAct, MINT CASP8 Biochemical Activity physical 18458084 , (Europe PMC )NA BioGRID CBWD6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CTNNB1 Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 20224040 , 21836063 , (Europe PMC )NA BioGRID DCAF10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID EDNRA Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11262386 , (Europe PMC )NA BioGRID EGFR Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, ubiquitin reconstruction physical, physical association 24658140 , 25402006 , (Europe PMC )0.51 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EP300 Affinity Capture-Western physical 15280364 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western physical 19917725 , (Europe PMC )NA BioGRID FLYWCH2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FOXA1 Affinity Capture-Western physical 19917725 , (Europe PMC )NA BioGRID FOXP3 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17360565 , (Europe PMC )0.40 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct GNMT Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT HDAC1 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC2 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC3 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 11466315 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct HDAC4 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC5 Reconstituted Complex physical 11279209 , (Europe PMC )NA BioGRID HDAC7 Affinity Capture-MS, Reconstituted Complex physical 11279209 , 23752268 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western, Two-hybrid physical 15280364 , 21148070 , (Europe PMC )NA BioGRID HINT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID IKZF1 Affinity Capture-Western physical 12015313 , (Europe PMC )NA BioGRID IKZF3 Affinity Capture-Western physical 12015313 , (Europe PMC )NA BioGRID IKZF4 Affinity Capture-Western physical 12015313 , (Europe PMC )NA BioGRID INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KAT5 Affinity Capture-Western, Two-hybrid physical 12551922 , (Europe PMC )NA BioGRID KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KDM5B Affinity Capture-Western physical 17373667 , (Europe PMC )NA BioGRID KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KLF4 Affinity Capture-Western physical 17827213 , (Europe PMC )NA BioGRID KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MARK2 Affinity Capture-Western, Biochemical Activity physical 16980613 , (Europe PMC )NA BioGRID MARK3 Affinity Capture-Western, Biochemical Activity physical 16980613 , (Europe PMC )NA BioGRID MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MEF2A Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16956611 , 16980305 , 20590529 , 22308472 , (Europe PMC )NA BioGRID MEF2C Affinity Capture-Western, Reconstituted Complex physical 11279209 , 18463162 , (Europe PMC )NA BioGRID MEF2C anti tag coimmunoprecipitation association 23752268 , (Europe PMC )0.35 IntAct MOCOS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID NCOR1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 11466315 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct NCOR2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 11466315 , 16956611 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct NR2E1 Affinity Capture-Western physical 17873065 , (Europe PMC )NA BioGRID NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID PML Affinity Capture-Western physical 18463162 , 22155184 , (Europe PMC )NA BioGRID PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1CB Affinity Capture-MS, Affinity Capture-Western physical 17369396 , (Europe PMC )NA BioGRID PPP1R12A Affinity Capture-MS, Affinity Capture-Western physical 17369396 , (Europe PMC )NA BioGRID PPP2CA Affinity Capture-Western, Biochemical Activity physical 18339811 , (Europe PMC )NA BioGRID PRKD1 Affinity Capture-Western physical 19029091 , (Europe PMC )NA BioGRID PRKD2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 17962809 , (Europe PMC )0.64 BioGRID, IntAct, MINT RAP1GDS1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID REL Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.49, 0.56 BioGRID, IntAct RHOA Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RIPPLY1 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID RIPPLY1 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.49, 0.56 IntAct RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID RUNX2 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 17997710 , (Europe PMC )NA BioGRID SDCBP phage display direct interaction 26787460 , (Europe PMC )0.44 IntAct, MINT SFN Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 15778465 , 18339811 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SHMT2 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TBL1X Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct TBL1XR1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , (Europe PMC )0.35 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct TTF2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID UBE2I Affinity Capture-Western, Reconstituted Complex physical 18625722 , (Europe PMC )NA BioGRID UGP2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WDR73 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17369396 , 23752268 , 24255178 , (Europe PMC )0.53 BioGRID, IntAct YWHAE Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17369396 , 17979178 , 20224040 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 23752268 , (Europe PMC )0.69 BioGRID, IntAct, MINT YWHAH Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 17979178 , 20224040 , 23752268 , 26496610 , (Europe PMC )0.35, 0.53 BioGRID, IntAct YWHAQ Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 15161933 , 16956611 , 16980613 , 17369396 , 23752268 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, coimmunoprecipitation, pull down association, physical, physical association 15161933 , 20224040 , 23752268 , (Europe PMC )0.67 BioGRID, IntAct, MINT ZBTB16 Reconstituted Complex physical 11929873 , (Europe PMC )NA BioGRID ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZFP36 Affinity Capture-Western physical 19738286 , (Europe PMC )NA BioGRID ZMYM6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ZYG11B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
MAP3K7 S155_FPLRKTVsEPNLKLR , NA NA PhosphoSitePlus , MARK2 S155_FPLRKTVsEPNLKLR , NA NA PhosphoSitePlus , MARK_group S155_FPLRKTVsEPNLKLR , LTP 16980613 ,(Europe PMC )PhosphoELM , PKD1 S155_FPLRKTVsEPNLKLR , LTP 15623513 , 18509061 , 18617643 ,(Europe PMC )PhosphoELM , PRKD1 S155_FPLRKTVsEPNLKLR , S181_NPLLRKEsAPPSLRR , S194_RRRPAETsGDSSPSS , S220_NDSEHGPsPILGSEA , S321_PSGSHAPsLTVPGLG , S358_WPLSRTRsEPLPPSA , S397_RSAKPSEsPRLRQIP , S486_RPLSRAQsSPAAPAS , in vitro, in vivo 15623513 , 15738054 , 16956611 , 18669648 , 18767875 , 20068231 ,(Europe PMC )HPRD, PhosphoSitePlus , Unknown S109_ERTVHPNsPGIPYRT , S148_PSDPPEHsPLRKTVS , S194_RRRPAETsGDSSPSS , S220_NDSEHGPsPILGSEA , S246_SVAPFALsTVSLLPA , S283_PRGPILGsPHTPLFL , S285_GPILGSPsTPLFLPH , S322_SGSHAPLsTVPGLGP , S358_WPLSRTRsEPLPPSA , S360_LSRTRSEsLPPSATA , S368_LPPSATAsPPPGPMQ , S397_RSAKPSEsPRLRQIP , S407_LRQIPSAsDLETDGG , S444_RGPAPLQsHPQVLLW , S449_LQQHPQVsLWEQQRL , S450_QQHPQVLsWEQQRLA , S486_RPLSRAQsSPAAPAS , S487_PLSRAQSsPAAPASL , S488_LSRAQSSsAAPASLS , S489_SRAQSSPsAPASLSA , S525_FTTGLIYsSVMLKHQ , S526_TTGLIYDsVMLKHQC , T249_PFALPTVtLLPAITL , T286_PILGSPHtPLFLPHG , T288_LGSPHTPtFLPHGLE , T319_LDPSGSHtPLLTVPG , T325_HAPLLTVtGLGPLPF , T356_LHWPLSRtRSEPLPP , T358_WPLSRTRtEPLPPSA , T395_IKRSAKPtEKPRLRQ , Y114_PNSPGIPyRTLEPLE , HTP, LTP, in vivo 15302935 , 15623513 , 16956611 , 17322306 , 18220336 , 18669648 , 18767875 , 19413330 , 19651622 , 19664995 , 20058876 , 20068231 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,
Statistics
