- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Deposit Data
- Acknowledgement
- Contact
- Licence
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- Catalytic Site Atlas
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetwoKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- NCI Nature PID
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- ArchSchema
- Cytoscape Web
- Europe PMC
- PTP-Central
- EKPD
- HuPHo
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last update: 11 Mar, 2019
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last update: 11 Mar, 2019
Top
ACTN1
Gene Name  | ACTN1 (QuickGO) | (A quick tutorial to explore the interctive visulaization) Representative structure: 2N8Z |
| Synonyms | ACTN1 | |
| Protein Name | ACTN1 | |
| Alternative Name(s) | Alpha-actinin-1;Alpha-actinin cytoskeletal isoform;F-actin cross-linking protein;Non-muscle alpha-actinin-1; | |
| Protein Family | Belongs to the alpha-actinin family | |
| EntrezGene ID | 87 (Comparitive Toxicogenomics) | |
| UniProt AC (Human) | P12814 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 103058 Dalton | |
| Protein Length | 892 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000072110 (Ensembl) | UCSC | 1000 Genomes | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0035 | eggNOG - COG5069 | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm, cytoskeletonCytoplasm, myofibril, sarcomere, Z line Cell membrane Cell junction Cell projection, ruffle Note=Colocalizes with MYOZ2 andPPP3CA at the Z-line of heart and skeletal muscle Colocalizeswith PSD in membrane ruffles and central reticular structures | |||
| Function (UniProt annotation) | |||
| F-actin cross-linking protein which is thought to anchoractin to a variety of intracellular structures This is a bundlingprotein | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKP ERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAP YKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYR RLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFR QKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPD ADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQAN VIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVD PNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYM SFSTALYGESDL | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001725 | C:stress fiber |
| GO:0001726 | C:ruffle |
| GO:0002576 | P:platelet degranulation |
| GO:0003725 | F:double-stranded RNA binding |
| GO:0005178 | F:integrin binding |
| GO:0005509 | F:calcium ion binding |
| GO:0005576 | C:extracellular region |
| GO:0005615 | C:extracellular space |
| GO:0005622 | C:intracellular |
| GO:0005737 | C:cytoplasm |
| GO:0005829 | C:cytosol |
| GO:0005886 | C:plasma membrane |
| GO:0005903 | C:brush border |
| GO:0005911 | C:cell-cell junction |
| GO:0005916 | C:fascia adherens |
| GO:0005925 | C:focal adhesion |
| GO:0007015 | P:actin filament organization |
| GO:0017166 | F:vinculin binding |
| GO:0030018 | C:Z disc |
| GO:0030220 | P:platelet formation |
| GO:0030374 | F:nuclear receptor transcription coactivator activity |
| GO:0031093 | C:platelet alpha granule lumen |
| GO:0031143 | C:pseudopodium |
| GO:0036344 | P:platelet morphogenesis |
| GO:0042803 | F:protein homodimerization activity |
| GO:0042981 | P:regulation of apoptotic process |
| GO:0042995 | C:cell projection |
| GO:0044325 | F:ion channel binding |
| GO:0048041 | P:focal adhesion assembly |
| GO:0051015 | F:actin filament binding |
| GO:0051017 | P:actin filament bundle assembly |
| GO:0051271 | P:negative regulation of cellular component movement |
| GO:0051639 | P:actin filament network formation |
| GO:0051764 | P:actin crosslink formation |
| GO:0070062 | C:extracellular exosome |
| GO:0098978 | C:glutamatergic synapse |
| GO:0099186 | F:structural constituent of postsynapse |
ACTN1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in ACTN1 (P12814) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PTPN1 | P18031 | Tyr-12 _QQTNDyMQPEE, | In vitro and in vivo | 16291744, | Europe PMC |  |
| PTPN6 | P29350 | NA | In vitro and in vivo | 15070900, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04510 | Focal adhesion | Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. |
| hsa04520 | Adherens junction | Cell-cell adherens junctions (AJs), the most common type of intercellular adhesions, are important for maintaining tissue architecture and cell polarity and can limit cell movement and proliferation. At AJs, E-cadherin serves as an essential cell adhesion molecules (CAMs). The cytoplasmic tail binds beta-catenin, which in turn binds alpha-catenin. Alpha-catenin is associated with F-actin bundles directly and indirectly. The integrity of the cadherin-catenin complex is negatively regulated by phosphorylation of beta-catenin by receptor tyrosine kinases (RTKs) and cytoplasmic tyrosine kinases (Fer, Fyn, Yes, and Src), which leads to dissociation of the cadherin-catenin complex. Integrity of this complex is positively regulated by beta -catenin phosphorylation by casein kinase II, and dephosphorylation by protein tyrosine phosphatases. Changes in the phosphorylation state of beta-catenin affect cell-cell adhesion, cell migration and the level of signaling beta-catenin. Wnt signaling acts as a positive regulator of beta-catenin by inhibiting beta-catenin degradation, which stabilizes beta-catenin, and causes its accumulation. Cadherin may acts as a negative regulator of signaling beta-catenin as it binds beta-catenin at the cell surface and thereby sequesters it from the nucleus. Nectins also function as CAMs at AJs, but are more highly concentrated at AJs than E-cadherin. Nectins transduce signals through Cdc42 and Rac, which reorganize the actin cytoskeleton, regulate the formation of AJs, and strengthen cell-cell adhesion. |
| hsa04530 | Tight junction | Tight junctions (TJs) are essential for establishing a selectively permeable barrier to diffusion through the paracellular space between neighboring cells. TJs are composed of at least three types of transmembrane protein -occludin, claudin and junctional adhesion molecules (JAMs)- and a cytoplasmic 'plaque' consisting of many different proteins that form large complexes. These are proposed to be involved in junction assembly, barrier regulation, cell polarity, gene transcription, and other pathways. |
| hsa04670 | Leukocyte transendothelial migration | Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion. |
| hsa04810 | Regulation of actin cytoskeleton | |
| hsa05146 | Amoebiasis | Entamoeba histolytica, an extracellular protozoan parasite is a human pathogen that invades the intestinal epithelium. Infection occurs on ingestion of contaminated water and food. The pathogenesis of amoebiasis begins with parasite attachment and disruption of the intestinal mucus layer, followed by apoptosis of host epithelial cells. Intestinal tissue destruction causes severe dysentery and ulcerations in amoebic colitis. Several amoebic proteins such as lectins, cysteine proteineases, and amoebapores are associated with the invasion process. The parasite can cause extraintestinal infection like amoebic liver abscess by evading immune response. |
| hsa05203 | Viral carcinogenesis | There is a strong association between viruses and the development of human malignancies. We now know that at least six human viruses, Epstein-Barr virus (EBV), hepatitis B virus (HBV), hepatitis C virus (HCV), human papilloma virus (HPV), human T-cell lymphotropic virus (HTLV-1) and Kaposi's associated sarcoma virus (KSHV) contribute to 10-15% of the cancers worldwide. Via expression of many potent oncoproteins, these tumor viruses promote an aberrant cell-proliferation via modulating cellular cell-signaling pathways and escape from cellular defense system such as blocking apoptosis. Human tumor virus oncoproteins can also disrupt pathways that are necessary for the maintenance of the integrity of host cellular genome. Viruses that encode such activities can contribute to initiation as well as progression of human cancers. |
| hsa05322 | Systemic lupus erythematosus | Systemic lupus erythematosus (SLE) is a prototypic autoimmune disease characterised by the production of IgG autoantibodies that are specific for self-antigens, such as DNA, nuclear proteins and certain cytoplasmic components, in association with a diverse array of clinical manifestations. The primary pathological findings in patients with SLE are those of inflammation, vasculitis, immune complex deposition, and vasculopathy. Immune complexes comprising autoantibody and self-antigen is deposited particulary in the renal glomeruli and mediate a systemic inflammatory response by activating complement or via Fc{gamma}R-mediated neutrophil and macrophage activation. Activation of complement (C5) leads to injury both through formation of the membrane attack complex (C5b-9) or by generation of the anaphylatoxin and cell activator C5a. Neutrophils and macrophages cause tissue injury by the release of oxidants and proteases. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-114608 | Platelet degranulation. | Platelets function as exocytotic cells, secreting a plethora of effector molecules at sites of vascular injury. Platelets contain a number of distinguishable storage granules including alpha granules, dense granules and lysosomes. On activation platelets release a variety of proteins, largely from storage granules but also as the result of apparent cell lysis. These act in an autocrine or paracrine fashion to modulate cell signaling. Alpha granules contain mainly polypeptides such as fibrinogen, von Willebrand factor, growth factors and protease inhibitors that that supplement thrombin generation at the site of injury. Dense granules contain small molecules, particularly adenosine diphosphate (ADP), adenosine triphosphate (ATP), serotonin and calcium, all recruit platelets to the site of injury. \n\nThe molecular mechanism which facilitates granule release involves soluble NSF attachment protein receptors (SNAREs), which assemble into complexes to form a universal membrane fusion apparatus. Although all cells use SNAREs for membrane fusion, different cells possess different SNARE isoforms. Platelets and chromaffin cells use many of the same chaperone proteins to regulate SNARE-mediated secretion (Fitch-Tewfik & Flaumenhaft 2013) |
| R-HSA-3000170 | Syndecan interactions. | Syndecans are type I transmembrane proteins, with an N-terminal ectodomain that contains several consensus sequences for glycosaminoglycan (GAG) attachment and a short C-terminal cytoplasmic domain. Syndecan-1 and -3 GAG attachment sites occur in two distinct clusters, one near the N-terminus and the other near the membrane-attachment site, separated by a proline and threonine-rich 'spacer'. Syndecan ectodomain sequences are poorly conserved in the family and between species, but the transmembrane and cytoplasmic domains are highly conserved. Syndecan-1 and -3 form a subfamily. Syndecan core proteins form dimers (Choi et al. 2007) and at least syndecan-3 and -4 form oligomers (Asundi & Carey 1995, Shin et al. 2012). Syndecan-1 is the major syndecan of epithelial cells including vascular endothelium. Syndecan-2 is present mostly in mesenchymal, neuronal and smooth muscle cells. Syndecan-3 is the major syndecan of the nervous system, while syndecan-4 is ubiquitously expressed but at lower levels than the other syndecans (refs in Alexopoulou et al. 2007). The core syndecan protein has three to five heparan sulfate or chondroitin sulfate chains, which interact with a variety of ligands including fibroblast growth factors, vascular endothelial growth factor, transforming growth factor-beta, fibronectin, collagen, vitronectin and several integrins. Syndecans may act as integrin coreceptors. Interactions between fibronectin and syndecans are modulated by tenascin-C. \n\nSyndecans bind a wide variety of soluble and insoluble ligands, inckluding extracellular matrix components, cell adhesion molecules, growth factors, cytokines, and proteinases. As the cleaved ectodomains of syndecans retain the ability to bind ligands, ectodomain shedding is a mechanism for releasing soluble effectors that may compete for ligands with their cell-bound counterparts (Kainulainen et al. 1998). Shed ectodomains are found in inflammatory fluids (Subramanian et al. 1997) and may induce the proliferation of cancer cells (Maeda et al. 2004) |
| R-HSA-373753 | Nephrin family interactions. | Nephrin (NPHS1) is a member of the Super-IgG-Molecule family and is most prominently expressed in kidney podocytes. It is a major if not the most important structural component of the slit diaphragm, a modified adherens junction inbetween these cells. NPHS1 has an extracellular domain that contains eight distal IgG like domains and one proximal fibronectin type III domain, a transmembrane domain and a short intracellular domain. NPHS1 molecules show both homophilic and heterophilic interactions. Among heterophilic interaction partners, slit diaphragm proteins such as Kin of IRRE-like protein 1 (KIRREL, Nephrin-like protein 1, NEPH1), KIRREL3 (NEPH2) and KIRREL2 (NEPH3) were shown to stabilize the slit diaphragm structure. Intracellularly Podocin (NPHS2), CD2 associated protein (CD2AP) and adherins junction associated proteins like IQGAP, MAGI, CASK and spectrins all interact with NPHS1. Hence it seems to play a major role in organizing the molecular structure of the slit diaphragm itself and via its binding partners links it to the actin cytoskeleton. NPHS1 tyrosine phosphorylation by the Src kinase FYN initiates the PI3K-AKT signaling cascade, which seems to promote antiapoptotic signals |
| R-HSA-446388 | Regulation of cytoskeletal remodeling and cell spreading by IPP complex components. | The PINCH-ILK-Parvin complexes function in transducing diverse signals from ECM to intracellular effectors. Interacting partners for components of these complexes have been identified, a number of which regulate and/or mediate its functions in cytoskeletal remodeling and cell spreading (reviewed in Wu, 2004) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTN2 | Co-fractionation, two hybrid array, two hybrid bait and prey pooling approach, validated two hybrid | physical, physical association | 22939629, 25910212, (Europe PMC) | 0.56 | BioGRID, IntAct |
| ACTN3 | Two-hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 25416956, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ACTN4 | Co-fractionation | physical | 22863883, 22939629, (Europe PMC) | NA | BioGRID |
| AMBRA1 | Affinity Capture-MS | physical | 25499913, (Europe PMC) | NA | BioGRID |
| ANLN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APC | Two-hybrid | physical | 20936779, (Europe PMC) | NA | BioGRID |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATXN2 | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATXN7 | Two-hybrid, two hybrid | physical, physical association | 21078624, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BTK | Affinity Capture-MS, pull down | association, physical | 21080425, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CACNA1A | Two-hybrid, two hybrid | physical, physical association | 21078624, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CALD1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CAMK2A | Co-localization, proximity ligation assay, two hybrid | physical, physical association | 12223541, 25241761, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| CAPZA2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBL | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CD81 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| CDAN1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDH1 | Affinity Capture-Western | physical | 9535896, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CDK5R1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 12223541, (Europe PMC) | NA | BioGRID |
| CDK5R2 | Reconstituted Complex, Two-hybrid | physical | 12223541, (Europe PMC) | NA | BioGRID |
| CEBPA | Affinity Capture-MS | physical | 17082780, (Europe PMC) | NA | BioGRID |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CKB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CLU | Affinity Capture-Western, Two-hybrid | physical | 17974975, (Europe PMC) | NA | BioGRID |
| COIL | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COL17A1 | Affinity Capture-Western, Two-hybrid | physical | 11739652, (Europe PMC) | NA | BioGRID |
| COX15 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSRP1 | Reconstituted Complex | physical | 10926853, (Europe PMC) | NA | BioGRID |
| CTNNA1 | Affinity Capture-Western, Co-localization, proximity ligation assay | physical, physical association | 25241761, 7790378, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYC1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DAG1 | Affinity Capture-Western, FRET | physical | 18341635, (Europe PMC) | NA | BioGRID |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCAF8 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DDIAS | Two-hybrid | physical | 28079882, (Europe PMC) | NA | BioGRID |
| DDN | Co-localization, Reconstituted Complex, Two-hybrid | physical | 16464232, (Europe PMC) | NA | BioGRID |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ECSIT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EPM2AIP1 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| ERBIN | Protein-peptide | physical | 15123239, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-MS, affinity chromatography technology | association, physical | 21182205, (Europe PMC) | 0.35 | BioGRID, IntAct |
| EZH2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| EZR | Co-fractionation, pull down | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAF2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| FXN | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GFI1B | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GIPC1 | Affinity Capture-Western, Reconstituted Complex | physical | 10198040, (Europe PMC) | NA | BioGRID |
| GIT2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GTF2H1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSF5 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-MS | physical | 16263121, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| HSPB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ICAM1 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IGSF8 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| ITGB1 | Reconstituted Complex | physical | 2116421, (Europe PMC) | NA | BioGRID |
| KAT2B | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| KCTD6 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| KDM5C | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KPNA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LUZP4 | Affinity Capture-MS | physical | 25662211, (Europe PMC) | NA | BioGRID |
| MAGEA11 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAP2 | Reconstituted Complex | physical | 2777757, (Europe PMC) | NA | BioGRID |
| MAP3K1 | Two-hybrid | physical | 14581471, (Europe PMC) | NA | BioGRID |
| MAPRE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MED14 | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| MICALL2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| MTNR1A | Two-hybrid, two hybrid | physical, physical association | 26514267, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MTNR1B | Two-hybrid, two hybrid | physical, physical association | 26514267, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYH15 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MYH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MYH9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO19 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MYOT | Affinity Capture-Western | physical | 12499399, (Europe PMC) | NA | BioGRID |
| MYOZ1 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| MYOZ2 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| NR1H3 | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUMBL | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OAS1 | Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 25910212, (Europe PMC) | 0.56 | BioGRID, IntAct |
| OBSL1 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| PALLD | Affinity Capture-Western | physical | 16125169, (Europe PMC) | NA | BioGRID |
| PARK7 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PDHX | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PDLIM1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10753915, 11110697, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PDLIM7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHB | Affinity Capture-Western | physical | 12628297, (Europe PMC) | NA | BioGRID |
| PIAS4 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PKN1 | Affinity Capture-Western | physical | 11802708, (Europe PMC) | NA | BioGRID |
| PPP1CB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Two-hybrid, two hybrid | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PYGB | Reconstituted Complex | physical | 12211109, (Europe PMC) | NA | BioGRID |
| RPS27 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SF3A3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SIRT6 | Affinity Capture-MS | physical | 24169447, (Europe PMC) | NA | BioGRID |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SLC2A4 | Affinity Capture-MS | physical | 16396496, (Europe PMC) | NA | BioGRID |
| SLC9A3R2 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SORBS2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 16125169, (Europe PMC) | NA | BioGRID |
| SPERT | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SRP19 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SSX2IP | Affinity Capture-Western, Reconstituted Complex | physical | 12446711, (Europe PMC) | NA | BioGRID |
| STAM2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SVIL | Affinity Capture-MS | physical | 12202484, (Europe PMC) | NA | BioGRID |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TERF1 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TERF2 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| TJP1 | Affinity Capture-MS | physical | 16944923, (Europe PMC) | NA | BioGRID |
| TPM1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPM2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPM3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPM4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TRAF3IP1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20391533, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TTN | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down | physical, physical association | 11101506, 11305911, 9501083, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TUBA1A | Affinity Capture-Western, FRET | physical | 18341635, (Europe PMC) | NA | BioGRID |
| VASP | Affinity Capture-Western | physical | 16376568, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| XRCC4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| ZYX | Reconstituted Complex, Two-hybrid, two hybrid | physical, physical association | 10224105, 11423549, (Europe PMC) | 0.37 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTB | cosedimentation, fluorescence microscopy | colocalization | 26879394, (Europe PMC) | 0.43 | IntAct, MINT |
| ACTN1 | Co-crystal Structure, Two-hybrid, two hybrid, two hybrid array | physical, physical association | 11423549, 11470434, 25416956, (Europe PMC) | 0.55 | BioGRID, IntAct |
| ACTN2 | Co-fractionation, two hybrid array, two hybrid bait and prey pooling approach, validated two hybrid | physical, physical association | 22939629, 25910212, (Europe PMC) | 0.56 | BioGRID, IntAct |
| ACTN3 | Two-hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 25416956, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ANLN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APC | two hybrid pooling approach | physical association | 20936779, (Europe PMC) | 0.37 | IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATXN2 | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATXN7 | Two-hybrid, two hybrid | physical, physical association | 21078624, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BTK | Affinity Capture-MS, pull down | association, physical | 21080425, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CACNA1A | Two-hybrid, two hybrid | physical, physical association | 21078624, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CAMK2A | Co-localization, proximity ligation assay, two hybrid | physical, physical association | 12223541, 25241761, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| CAPZA2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| COIL | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COX15 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CTNNA1 | Affinity Capture-Western, Co-localization, proximity ligation assay | physical, physical association | 25241761, 7790378, (Europe PMC) | 0.40 | BioGRID, IntAct |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| EPM2AIP1 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| ESR1 | Affinity Capture-MS, affinity chromatography technology | association, physical | 21182205, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR2 | affinity chromatography technology, tandem affinity purification | association | 21182203, 25604459, (Europe PMC) | 0.53 | IntAct |
| EZR | Co-fractionation, pull down | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FXN | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GFI1B | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GIT2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| GTF2H1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSF5 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| HSPB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| IQGAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KCTD6 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| KPNA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAGEA11 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAPRE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MICALL2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| MTNR1A | Two-hybrid, two hybrid | physical, physical association | 26514267, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MTNR1B | Two-hybrid, two hybrid | physical, physical association | 26514267, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYH9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO19 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MYOZ1 | two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach | physical association | 16189514, (Europe PMC) | 0.62 | IntAct |
| MYOZ2 | two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical association | 25416956, 25910212, (Europe PMC) | 0.79 | IntAct |
| NUMBL | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OAS1 | Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 25910212, (Europe PMC) | 0.56 | BioGRID, IntAct |
| PARK7 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PDHX | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PDLIM7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PIAS4 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PLEK | anti bait coimmunoprecipitation, pull down | association | 19722192, (Europe PMC) | 0.46 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PPP1CB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Two-hybrid, two hybrid | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPN1 | phosphatase assay | dephosphorylation reaction | 16291744, (Europe PMC) | 0.44 | IntAct |
| RPS27 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SCRIB | phage display | physical association | 24550280, (Europe PMC) | 0.40 | IntAct, MINT |
| SLC9A3R2 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SPERT | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SRC | anti bait coimmunoprecipitation, pull down | physical association | 16291744, (Europe PMC) | 0.52 | IntAct |
| SUN2 | pull down | association | 22555292, (Europe PMC) | 0.35 | IntAct |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRAF3IP1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20391533, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TTN | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down | physical, physical association | 11101506, 11305911, 9501083, (Europe PMC) | 0.40 | BioGRID, IntAct |
| XRCC4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ZYX | Reconstituted Complex, Two-hybrid, two hybrid | physical, physical association | 10224105, 11423549, (Europe PMC) | 0.37 | BioGRID, IntAct |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| CAMK2A | Co-localization, proximity ligation assay, two hybrid | physical, physical association | 12223541, 25241761, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| SCRIB | phage display | physical association | 24550280, (Europe PMC) | 0.40 | IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACTB | cosedimentation, fluorescence microscopy | colocalization | 26879394, (Europe PMC) | 0.43 | IntAct, MINT |
| ACTN1 | Co-crystal Structure, Two-hybrid, two hybrid, two hybrid array | physical, physical association | 11423549, 11470434, 25416956, (Europe PMC) | 0.55 | BioGRID, IntAct |
| ACTN2 | Co-fractionation, two hybrid array, two hybrid bait and prey pooling approach, validated two hybrid | physical, physical association | 22939629, 25910212, (Europe PMC) | 0.56 | BioGRID, IntAct |
| ACTN3 | Two-hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 25416956, (Europe PMC) | 0.49 | BioGRID, IntAct |
| ACTN4 | Co-fractionation | physical | 22863883, 22939629, (Europe PMC) | NA | BioGRID |
| AMBRA1 | Affinity Capture-MS | physical | 25499913, (Europe PMC) | NA | BioGRID |
| ANLN | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| APC | Two-hybrid | physical | 20936779, (Europe PMC) | NA | BioGRID |
| APC | two hybrid pooling approach | physical association | 20936779, (Europe PMC) | 0.37 | IntAct |
| ATF2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 22304920, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ATXN2 | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ATXN7 | Two-hybrid, two hybrid | physical, physical association | 21078624, (Europe PMC) | 0.37 | BioGRID, IntAct |
| BCAR1 | anti bait coimmunoprecipitation | association | 28007913, (Europe PMC) | 0.35 | IntAct |
| BMI1 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| BTK | Affinity Capture-MS, pull down | association, physical | 21080425, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CACNA1A | Two-hybrid, two hybrid | physical, physical association | 21078624, (Europe PMC) | 0.37 | BioGRID, IntAct |
| CALD1 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| CAMK2A | Co-localization, proximity ligation assay, two hybrid | physical, physical association | 12223541, 25241761, (Europe PMC) | 0.57 | BioGRID, IntAct, MINT |
| CAPZA2 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CBL | Affinity Capture-MS | physical | 19380743, (Europe PMC) | NA | BioGRID |
| CD81 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| CDAN1 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| CDC73 | Affinity Capture-MS | physical | 27462432, (Europe PMC) | NA | BioGRID |
| CDH1 | Affinity Capture-Western | physical | 9535896, (Europe PMC) | NA | BioGRID |
| CDK2 | Affinity Capture-MS | physical | 21319273, (Europe PMC) | NA | BioGRID |
| CDK5R1 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 12223541, (Europe PMC) | NA | BioGRID |
| CDK5R2 | Reconstituted Complex, Two-hybrid | physical | 12223541, (Europe PMC) | NA | BioGRID |
| CEBPA | Affinity Capture-MS | physical | 17082780, (Europe PMC) | NA | BioGRID |
| CFTR | Affinity Capture-MS | physical | 26618866, (Europe PMC) | NA | BioGRID |
| CKB | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| CLU | Affinity Capture-Western, Two-hybrid | physical | 17974975, (Europe PMC) | NA | BioGRID |
| COIL | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| COL17A1 | Affinity Capture-Western, Two-hybrid | physical | 11739652, (Europe PMC) | NA | BioGRID |
| COX15 | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| CSRP1 | Reconstituted Complex | physical | 10926853, (Europe PMC) | NA | BioGRID |
| CTNNA1 | Affinity Capture-Western, Co-localization, proximity ligation assay | physical, physical association | 25241761, 7790378, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CUL7 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| CYC1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| DAG1 | Affinity Capture-Western, FRET | physical | 18341635, (Europe PMC) | NA | BioGRID |
| DBN1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DCAF8 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| DDIAS | Two-hybrid | physical | 28079882, (Europe PMC) | NA | BioGRID |
| DDN | Co-localization, Reconstituted Complex, Two-hybrid | physical | 16464232, (Europe PMC) | NA | BioGRID |
| DLD | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DNM1L | Affinity Capture-MS, cross-linking study | association, physical | 29128334, (Europe PMC) | 0.35 | BioGRID, IntAct |
| DUX4 | pull down | association | 26816005, (Europe PMC) | 0.35 | IntAct |
| ECSIT | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| EPM2AIP1 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| ERBIN | Protein-peptide | physical | 15123239, (Europe PMC) | NA | BioGRID |
| ESR1 | Affinity Capture-MS, affinity chromatography technology | association, physical | 21182205, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ESR2 | affinity chromatography technology, tandem affinity purification | association | 21182203, 25604459, (Europe PMC) | 0.53 | IntAct |
| EZH2 | Affinity Capture-MS | physical | 24457600, (Europe PMC) | NA | BioGRID |
| EZR | Co-fractionation, pull down | association, physical | 22939629, 29568061, (Europe PMC) | 0.35 | BioGRID, IntAct |
| FAF2 | Co-fractionation | physical | 22939629, (Europe PMC) | NA | BioGRID |
| FXN | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GABARAPL1 | anti tag coimmunoprecipitation | association | 20562859, (Europe PMC) | 0.35 | IntAct |
| GFI1B | Two-hybrid, two hybrid | physical, physical association | 16713569, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GIPC1 | Affinity Capture-Western, Reconstituted Complex | physical | 10198040, (Europe PMC) | NA | BioGRID |
| GIT2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| GRB2 | pull down | association | 12577067, (Europe PMC) | 0.35 | IntAct |
| GTF2H1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| HSF5 | Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 25036637, (Europe PMC) | 0.35 | BioGRID, IntAct |
| HSP90AA1 | Affinity Capture-MS | physical | 16263121, (Europe PMC) | NA | BioGRID |
| HSP90AB1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 16263121, (Europe PMC) | 0.35 | BioGRID, IntAct, MINT |
| HSPB1 | Two-hybrid, reverse ras recruitment system | physical, physical association | 25277244, (Europe PMC) | 0.37 | BioGRID, IntAct |
| ICAM1 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IGSF8 | Affinity Capture-MS, Affinity Capture-Western | physical | 23463506, (Europe PMC) | NA | BioGRID |
| IQGAP1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| ISG15 | Affinity Capture-MS | physical | 16009940, (Europe PMC) | NA | BioGRID |
| ITGB1 | Reconstituted Complex | physical | 2116421, (Europe PMC) | NA | BioGRID |
| JUN | anti bait coimmunoprecipitation | association | 25609649, (Europe PMC) | 0.35 | IntAct, MINT |
| KAT2B | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| KCTD6 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| KDM5C | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| KEAP1 | Affinity Capture-MS | physical | 27621311, (Europe PMC) | NA | BioGRID |
| KPNA2 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| LUZP4 | Affinity Capture-MS | physical | 25662211, (Europe PMC) | NA | BioGRID |
| MAGEA11 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MAP2 | Reconstituted Complex | physical | 2777757, (Europe PMC) | NA | BioGRID |
| MAP3K1 | Two-hybrid | physical | 14581471, (Europe PMC) | NA | BioGRID |
| MAPRE1 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MCM2 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MCM5 | Affinity Capture-MS | physical | 25963833, (Europe PMC) | NA | BioGRID |
| MED14 | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| MICALL2 | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.70 | BioGRID, IntAct |
| MTNR1A | Two-hybrid, two hybrid | physical, physical association | 26514267, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MTNR1B | Two-hybrid, two hybrid | physical, physical association | 26514267, (Europe PMC) | 0.37 | BioGRID, IntAct |
| MYH15 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MYH2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| MYH9 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| MYO19 | Affinity Capture-MS | physical | 26496610, (Europe PMC) | NA | BioGRID |
| MYO19 | anti tag coimmunoprecipitation | association | 26496610, (Europe PMC) | 0.35 | IntAct |
| MYOT | Affinity Capture-Western | physical | 12499399, (Europe PMC) | NA | BioGRID |
| MYOZ1 | Two-hybrid | physical | 16189514, (Europe PMC) | NA | BioGRID |
| MYOZ1 | two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach | physical association | 16189514, (Europe PMC) | 0.62 | IntAct |
| MYOZ2 | Two-hybrid | physical | 25416956, (Europe PMC) | NA | BioGRID |
| MYOZ2 | two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical association | 25416956, 25910212, (Europe PMC) | 0.79 | IntAct |
| NR1H3 | Two-hybrid | physical | 15604093, (Europe PMC) | NA | BioGRID |
| NTRK1 | Affinity Capture-MS | physical | 25921289, (Europe PMC) | NA | BioGRID |
| NUMBL | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| OAS1 | Two-hybrid, two hybrid array, two hybrid bait and prey pooling approach, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, 25910212, (Europe PMC) | 0.56 | BioGRID, IntAct |
| OBSL1 | Affinity Capture-MS | physical | 24711643, (Europe PMC) | NA | BioGRID |
| PALLD | Affinity Capture-Western | physical | 16125169, (Europe PMC) | NA | BioGRID |
| PARK7 | Affinity Capture-MS | physical | 29128334, (Europe PMC) | NA | BioGRID |
| PARK7 | cross-linking study | association | 29128334, (Europe PMC) | 0.35 | IntAct |
| PDHX | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PDLIM1 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10753915, 11110697, 26186194, 28514442, (Europe PMC) | NA | BioGRID |
| PDLIM7 | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PHB | Affinity Capture-Western | physical | 12628297, (Europe PMC) | NA | BioGRID |
| PIAS4 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PKN1 | Affinity Capture-Western | physical | 11802708, (Europe PMC) | NA | BioGRID |
| PLEK | anti bait coimmunoprecipitation, pull down | association | 19722192, (Europe PMC) | 0.46 | IntAct |
| PLEKHA7 | anti bait coimmunoprecipitation | association | 28877994, (Europe PMC) | 0.35 | IntAct |
| PPP1CB | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| PSEN1 | Two-hybrid, two hybrid | physical, physical association | 21163940, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PSMA1 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| PTPN1 | phosphatase assay | dephosphorylation reaction | 16291744, (Europe PMC) | 0.44 | IntAct |
| PYGB | Reconstituted Complex | physical | 12211109, (Europe PMC) | NA | BioGRID |
| RPS27 | Two-hybrid, two hybrid | physical, physical association | 21988832, (Europe PMC) | 0.37 | BioGRID, IntAct |
| SCRIB | phage display | physical association | 24550280, (Europe PMC) | 0.40 | IntAct, MINT |
| SF3A3 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SIRT6 | Affinity Capture-MS | physical | 24169447, (Europe PMC) | NA | BioGRID |
| SIRT7 | Affinity Capture-MS | physical | 22586326, (Europe PMC) | NA | BioGRID |
| SLC2A4 | Affinity Capture-MS | physical | 16396496, (Europe PMC) | NA | BioGRID |
| SLC9A3R2 | Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification | association, physical, physical association | 27173435, (Europe PMC) | 0.51 | BioGRID, IntAct |
| SORBS2 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 16125169, (Europe PMC) | NA | BioGRID |
| SPERT | Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid | physical, physical association | 25416956, (Europe PMC) | 0.56 | BioGRID, IntAct |
| SRC | anti bait coimmunoprecipitation, pull down | physical association | 16291744, (Europe PMC) | 0.52 | IntAct |
| SRP19 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SSX2IP | Affinity Capture-Western, Reconstituted Complex | physical | 12446711, (Europe PMC) | NA | BioGRID |
| STAM2 | Co-fractionation | physical | 22863883, (Europe PMC) | NA | BioGRID |
| SUN2 | pull down | association | 22555292, (Europe PMC) | 0.35 | IntAct |
| SVIL | Affinity Capture-MS | physical | 12202484, (Europe PMC) | NA | BioGRID |
| SYNPO | Affinity Capture-MS, anti tag coimmunoprecipitation | association, physical | 26496610, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TERF1 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TERF2 | Affinity Capture-MS | physical | 20811636, (Europe PMC) | NA | BioGRID |
| TES | Affinity Capture-MS | physical | 28378594, (Europe PMC) | NA | BioGRID |
| TJP1 | Affinity Capture-MS | physical | 16944923, (Europe PMC) | NA | BioGRID |
| TPM1 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPM2 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPM3 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TPM4 | Co-fractionation | physical | 26344197, (Europe PMC) | NA | BioGRID |
| TRAF3IP1 | Affinity Capture-MS, anti bait coimmunoprecipitation | association, physical | 20391533, (Europe PMC) | 0.35 | BioGRID, IntAct |
| TRIM25 | Affinity Capture-RNA | physical | 29117863, (Europe PMC) | NA | BioGRID |
| TTN | Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down | physical, physical association | 11101506, 11305911, 9501083, (Europe PMC) | 0.40 | BioGRID, IntAct |
| TUBA1A | Affinity Capture-Western, FRET | physical | 18341635, (Europe PMC) | NA | BioGRID |
| VASP | Affinity Capture-Western | physical | 16376568, (Europe PMC) | NA | BioGRID |
| VCP | Affinity Capture-MS | physical | 23383273, (Europe PMC) | NA | BioGRID |
| XRCC4 | Two-hybrid, two hybrid pooling approach | physical, physical association | 16189514, (Europe PMC) | 0.37 | BioGRID, IntAct |
| YAP1 | Affinity Capture-MS | physical | 25796446, (Europe PMC) | NA | BioGRID |
| ZNF746 | Affinity Capture-MS | physical | 25315684, (Europe PMC) | NA | BioGRID |
| ZYX | Reconstituted Complex, Two-hybrid, two hybrid | physical, physical association | 10224105, 11423549, (Europe PMC) | 0.37 | BioGRID, IntAct |
| Phosphorylating Kinases | Phosphoresidues | Detection Method | PubMed IDs | Source |
| FAK | Y12_DSQQTNDyMQPEEDW, | LTP | 11369769,(Europe PMC) | PhosphoELM, |
| PTK2 | Y12_DSQQTNDyMQPEEDW, | NA | 11369769, 16291744,(Europe PMC) | HPRD, PhosphoSitePlus, |
| Unknown | S140_RFAIQDIsVEETSAK, T50_SHLRKAGtQIENIEE, Y193_HRPELIDyGKLRKDD, | HTP, in vivo | 16097034, 17081983, 18083107, 18452278, 18669648, 19664994, 19664995, 20166139,(Europe PMC) | HPRD, PhosphoELM, |